| Gene Name |
Chorion factor 2 |
| Gene Symbol |
Cf2 |
| Secondary ID |
CG11924 |
| Synonyms |
BcDNA:GM09668 CF2 CF2.5 CG11924 Cf2 cf2 |
| Protein ID |
CF23_DROME |
| Unipro ID |
Q01522 |
| FlyMine |
Link to FlyMine |
| Primary DNAbindingDomain |
zf-C2H2 |
| Secondary DNAbindingDomain |
|
| Pfam Domain |
zf-C2H2 |
|
| Motif |
Frequency Matrix |
Other Information |
|
|
| Motif frequency in Drosophila genome |
Genome Surveyor |
| Source |
B1H |
| Sequence Method |
SOLEXA |
| PubmedID |
0 |
| Vector |
omegaUV5 |
| Inhibitor Concentration |
2.5 mM |
| Inducer Concentration |
10 μM |
| AA sequence of fragment |
KIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFRCGYCGRAFTVKDYLNKHLTTHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHPL |
|
|
| Motif |
Frequency Matrix |
Other Information |
|
|
| Motif frequency in Drosophila genome |
Genome Surveyor |
| Source |
B1H |
| Sequence Method |
SOLEXA |
| PubmedID |
0 |
| Vector |
omegaUV5 |
| Inhibitor Concentration |
5 mM |
| Inducer Concentration |
10 μM |
| AA sequence of fragment |
KIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHPL |
|
|
| Motif |
Frequency Matrix |
Other Information |
|
|
| Motif frequency in Drosophila genome |
Genome Surveyor |
| Source |
B1H |
| Sequence Method |
SANGER |
| PubmedID |
|
| Vector |
omegaUV5 |
| Inhibitor Concentration |
5 mM |
| Inducer Concentration |
10 μM |
| AA sequence of fragment |
KIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHPL |
|
|
| Motif |
Frequency Matrix |
Other Information |
|
|
| Motif frequency in Drosophila genome |
Genome Surveyor |
| Source |
B1H |
| Sequence Method |
SANGER |
| PubmedID |
|
| Vector |
omegaUV5 |
| Inhibitor Concentration |
2.5 mM |
| Inducer Concentration |
10 μM |
| AA sequence of fragment |
KIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFRCGYCGRAFTVKDYLNKHLTTHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHPL |
|
|
| Motif |
Frequency Matrix |
Other Information |
|
|
| Motif frequency in Drosophila genome |
Genome Surveyor |
| Source |
DNaseI |
| Sequence Method |
SANGER |
| PubmedID |
15572468 |
| Vector |
|
| Inhibitor Concentration |
|
| Inducer Concentration |
|
| AA sequence of fragment |
|
|
|