TFDBS db
Welcome: Guest Browse Download and Resources   Log on   Go to homepage




Summary page for FlybaseID: FBgn0035160 from the database of Drosophila TF DNA-binding Specificities
Gene Name CG13897 
Gene Symbol CG13897 
Secondary ID CG13897 
Synonyms CG13897 anon-WO0118547.557 
Protein ID Q8SYS1_DROME 
Unipro ID Q8SYS1 
FlyMine Link to FlyMine 
Primary DNAbindingDomain MADF_DNA_bdg 
Secondary DNAbindingDomain  
Pfam Domain BESS; MADF_DNA_bdg 
Motif Frequency Matrix Other Information
Logo






?




Motif frequency in Drosophila genome Genome Surveyor
Source B1H 
Sequence Method SANGER 
PubmedID  
Vector omegalppC 
Inhibitor Concentration (mM)
Inducer Concentration (┬ÁM) 10 
AA sequence of fragment MDMHRLIFEVQQRRALWDARHPDHANRPETQRLWNAVAEATGMDVELCRTKWKNLRCSYRRSNRRSGILKHQQSPSPGHQWSYAEAMSFLDGQREECDNSNNGEEEMESA 


Questions and comments can be sent to: Michael Brodsky   or    Scot Wolfe

Database and website designed by Julie Zhu

Link to UMASS